SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003744 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003744
Domain Number 1 Region: 249-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000351
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 346-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000429
Family I set domains 0.052
Further Details:      
 
Domain Number 3 Region: 136-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000456
Family I set domains 0.05
Further Details:      
 
Domain Number 4 Region: 430-514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000952
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 33-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000446
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003744   Gene: ENSGGOG00000003810   Transcript: ENSGGOT00000003832
Sequence length 646
Comment pep:known_by_projection chromosome:gorGor3.1:11:117255836:117263944:-1 gene:ENSGGOG00000003810 transcript:ENSGGOT00000003832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHV
DWFSVHKEKRTLIFRVRHGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKR
PRSQEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRP
LKEEKNRVHIQSSQTVESSGLYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESRE
VTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAEEETTN
DNGVLVLEPARKEHSGRYECQGLDLDTMISLPSEPQELLVNYVSDVRVSPAAPEKQEGSS
LTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGSYRCVASVPSIPGLNRT
QLVKVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRV
LSTLNVLVTPELLETGVECTASNDLGKNTSVLFLELVNLTTLTPDSNTTTGLSTSTASPH
TRANSTSTERKLPEPESQGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCGRSGKQEITL
PPSRKSEFIVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Download sequence
Identical sequences G3QMK3
ENSGGOP00000003744 ENSGGOP00000003744 XP_004052321.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]