SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003777 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003777
Domain Number 1 Region: 38-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000113
Family I set domains 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003777   Gene: ENSGGOG00000003846   Transcript: ENSGGOT00000003868
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:1:140589940:140604160:1 gene:ENSGGOG00000003846 transcript:ENSGGOT00000003868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCRGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQELFSSKPVTITVQAPTVGSSSPMGITVAVVIATAVAAIVAAVVALI
YCRKKQISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLKPRAPTDD
DKNIYLTLPPNDHVNSNN
Download sequence
Identical sequences ENSGGOP00000003777 ENSGGOP00000003777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]