SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003787 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003787
Domain Number 1 Region: 86-170
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-16
Family I set domains 0.00000656
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000253
Family I set domains 0.0000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003787   Gene: ENSGGOG00000003859   Transcript: ENSGGOT00000003880
Sequence length 263
Comment pep:known_by_projection chromosome:gorGor3.1:1:140759931:140766094:1 gene:ENSGGOG00000003859 transcript:ENSGGOT00000003880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANN
DSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFF
QNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQTPSSSPMGIIV
AVVTGIAVAAIVAAVVALIYCRKKRISALGYPECREMRETLPEKPANPTNPDEADKVGAE
NTITYSLLMHPDALEEPDDQNRI
Download sequence
Identical sequences ENSGGOP00000003787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]