SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003995 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003995
Domain Number 1 Region: 30-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000375
Family I set domains 0.078
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003995
Domain Number - Region: 148-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00014
Family I set domains 0.034
Further Details:      
 
Domain Number - Region: 272-309
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0301
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003995   Gene: ENSGGOG00000004070   Transcript: ENSGGOT00000004092
Sequence length 332
Comment pep:known_by_projection chromosome:gorGor3.1:1:139547875:139590785:-1 gene:ENSGGOG00000004070 transcript:ENSGGOT00000004092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLFQSLLFVFCFGPGNVVSQSSSTPLMVNGILGESVTLPLEFPAGEKVDSITWLCNGT
SLAFIVPHETKSPEIHMTNPKQGKRLKFTQSYSLQLSNLKMEDTGSYSAQISTKTSAKLS
SYTLRILRQLRNIQVTNHSQLFQNRTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLT
VSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCGDVKIQYTDTKMILFTVSGICIVFGF
IILLLLFLRKRRDSLSLSTQRTQGPAESAGNLEYVSVSPTNNTVYASVTHSNRETEIWTP
TENDTITIYSTINHSKESKPTFSRATALDNVV
Download sequence
Identical sequences ENSGGOP00000003995 XP_018880872.1.27298 ENSGGOP00000003995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]