SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004012 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004012
Domain Number 1 Region: 700-901
Classification Level Classification E-value
Superfamily Fibronectin type III 9.28e-40
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 2 Region: 501-691
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-34
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 371-466
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 149-249
Classification Level Classification E-value
Superfamily Immunoglobulin 6.73e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 1344-1432
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 274-366
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000004
Family I set domains 0.03
Further Details:      
 
Domain Number 7 Region: 1128-1207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000139
Family I set domains 0.07
Further Details:      
 
Domain Number 8 Region: 1015-1094
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000172
Family I set domains 0.073
Further Details:      
 
Domain Number 9 Region: 1249-1298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000289
Family I set domains 0.034
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004012
Domain Number - Region: 915-990
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00246
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004012   Gene: ENSGGOG00000004080   Transcript: ENSGGOT00000004109
Sequence length 1440
Comment pep:known_by_projection chromosome:gorGor3.1:1:24871869:24923693:-1 gene:ENSGGOG00000004080 transcript:ENSGGOT00000004109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLPHSLGGAGEPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSSVRRRTFRSSSEEEHE
FSAADYALAAALALTASSELSWEAQLRCQTSAVELEERGQKRVGFGNDWERTEIAFLQTH
RLLRQRRDWKLLRQRTEEKVQEAKELRELCSGRGPWFWIPLRSHAVWEHTTVLLTCTVQA
SPPPQVTWYKNDTRIDPRLFPAGKYRITNNYGLLSLEIRRCTIEDSATYTVRVKNAYGQA
SSFAKVLVRTYLGKDAGFDSEIFKRSMFGPSVEFTSVLKPVFAREKEPFSLSCLFSEDVL
DAESIQWFRDGRLLRSSRRRKILYADRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTY
VLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYSIERCQGESGEW
IPCHEAPGGTCRCPIQGLVEGQSYRFRVRAISRAGSSVPSKASELVVMGDHDAARRKTEI
PFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRGRAPLTYSLEKS
VIGSGTWEAISSESPVKSPRFAVLDLEKKKSYVFRVRAMNQYGLSDPSEPSEPIALRGPP
ATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYIYSRKVGTSEWQTVNNKPIQGTRFT
VPGLRTGKEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIG
WKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANW
AGVGELSAPSSLFECKEWTMPQPGPPYDVRASEVRATSLVLQWEPPLYTGAGPVTGYHVS
FQEEGSEQWKPVTPGPVSGTHLRVSDLQPGKSYVFQVQAVNSAGLGQPSMPTDPVLLEDK
PGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILK
EPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILER
GEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFEREKGLVEVIIQNLSEEDKGSYT
AQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGTGPYFEQPLQWKVTEDCQVQ
LTCKVTNTKKETRFQWFFQRAEMSDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGE
DDTILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHK
DKRLESGDRIRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAM
AEHQRLKTLAIIEKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTF
LDRYRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM
Download sequence
Identical sequences ENSGGOP00000004012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]