SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004205 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004205
Domain Number 1 Region: 34-243
Classification Level Classification E-value
Superfamily alpha/beta knot 2.35e-79
Family EMG1/NEP1-like 0.000000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004205   Gene: ENSGGOG00000004287   Transcript: ENSGGOT00000004308
Sequence length 244
Comment pep:novel chromosome:gorGor3.1:12:7172349:7177583:1 gene:ENSGGOG00000004287 transcript:ENSGGOT00000004308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKT
YELLNCDKHKSVLLKNGWDPGEVRPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEV
NPQTRIPRTFDRFCGLMVQLLHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSI
PVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEV
WGVI
Download sequence
Identical sequences G3QNS9
XP_004052659.1.27298 ENSGGOP00000004205 ENSGGOP00000004205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]