SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004210 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004210
Domain Number 1 Region: 55-338
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.76e-81
Family Regulator of chromosome condensation RCC1 0.02
Further Details:      
 
Domain Number 2 Region: 377-486
Classification Level Classification E-value
Superfamily POZ domain 6.8e-23
Family BTB/POZ domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004210   Gene: ENSGGOG00000004291   Transcript: ENSGGOT00000004313
Sequence length 551
Comment pep:known_by_projection chromosome:gorGor3.1:13:30676183:30720264:-1 gene:ENSGGOG00000004291 transcript:ENSGGOT00000004313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLY
TTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEV
FTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNN
SGQVGSGSTVNQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGLG
NSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKSNQSYP
TPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACF
ATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFR
SSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQ
QTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFI
SKASRVGAFKN
Download sequence
Identical sequences A0A2I3T7E9 A0A2J8VSE3 G1QT21 G3QNT4 O95199 Q5RCZ7
gi|4557445|ref|NP_001259.1| HR6030 OPTIC302 NP_001125174.1.23681 NP_001259.1.87134 NP_001259.1.92137 XP_003270124.1.23891 XP_003811474.1.60992 XP_004054550.1.27298 XP_005266299.1.92137 XP_006719822.1.92137 XP_016781187.1.37143 XP_016781188.1.37143 ENSNLEP00000004089 ENSGGOP00000004210 9600.ENSPPYP00000006106 9606.ENSP00000345144 ENSP00000345144 ENSPPYP00000006106 ENSP00000345144 ENSPPYP00000006106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]