SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004247 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004247
Domain Number 1 Region: 397-516
Classification Level Classification E-value
Superfamily POZ domain 2.51e-24
Family BTB/POZ domain 0.0059
Further Details:      
 
Domain Number 2 Region: 64-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000821
Family G proteins 0.0066
Further Details:      
 
Domain Number 3 Region: 236-285,318-352
Classification Level Classification E-value
Superfamily POZ domain 0.0000149
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004247   Gene: ENSGGOG00000004327   Transcript: ENSGGOT00000004350
Sequence length 610
Comment pep:known_by_projection chromosome:gorGor3.1:5:78715505:78779847:1 gene:ENSGGOG00000004327 transcript:ENSGGOT00000004350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQAS
AFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVNDKFSFHEVKDNYIPVIKR
ALNSVPVIIAAVGTRQNEELPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDF
YIGKYFGGVLEYFMIQALNQKTSEKMKKRKMSNSFHGIRPPQLEQPEKMPVLKAEASHYN
SDLNNLLFCCQCVDVVFYNPDLKEVVEAHKIVLCAVSHVFMLLFNVKSPTDIQDSSIIRT
TQDLFAINRDTAFPGASHESSGNPPLRVIVKDALFCSCLSDILRFIYSGAFQWEELEEDI
RKKLKDSGDVSDVIEKVKCILKTPGKINCLRNCKTYQARKPLWFYNTSLKFFLNKPMLAD
VVFEIQGTTVPAHRAILVARCEVMAAMFNGNYMEAKSVLIPVYGVSKETFLSFLEYLYTD
SCCPAGIFQAMCLLICAEMYQVSRLQHICELFIITQLQSMPSRELASMNLDIVDLLKKAK
FHHSDCLSTWLLHFIATNYLIFSQKPEFQDLSVEERSFVEKHRWPSNMYLKQLAEYRKYI
HSRKCRCLVM
Download sequence
Identical sequences ENSGGOP00000004247 ENSGGOP00000004247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]