SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004293 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004293
Domain Number 1 Region: 29-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000224
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004293   Gene: ENSGGOG00000004376   Transcript: ENSGGOT00000004399
Sequence length 320
Comment pep:known_by_projection chromosome:gorGor3.1:10:60803211:60900389:-1 gene:ENSGGOG00000004376 transcript:ENSGGOT00000004399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMPRALQAGWMQQPGPAPKVCAALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAV
RWFFAHSSDSQEALMVKMTKLRVVQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLTLQPS
DQGHYVCRVQEISRHRNKWTAWSNGSSATEMRVISLKASEESSFEKTKETWAFFEDLYVY
AVLVCCVGILSILLFMLVIVWQSVFNKRKSRVRHYLVKCPQNSSGETVTSVTSLAPLQPK
KGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRA
AKGAPTSTVYAQILFEENKL
Download sequence
Identical sequences G3QP10
ENSGGOP00000019681 ENSGGOP00000004293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]