SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004332 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004332
Domain Number 1 Region: 110-235
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-47
Family Fibronectin type III 0.000000219
Further Details:      
 
Domain Number 2 Region: 236-327
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000112
Family Fibronectin type III 0.00000211
Further Details:      
 
Domain Number 3 Region: 31-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000242
Family I set domains 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004332   Gene: ENSGGOG00000004419   Transcript: ENSGGOT00000004439
Sequence length 330
Comment pep:known_by_projection chromosome:gorGor3.1:5:143404497:143416562:-1 gene:ENSGGOG00000004419 transcript:ENSGGOT00000004439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTSEEDGITW
TLDQSSEVSGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KDPEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAE
RVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPP
KNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATV
ICRKNASISVRAQDRYYSSSWSEWASVPCS
Download sequence
Identical sequences ENSGGOP00000004332 ENSGGOP00000004332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]