SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004396 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004396
Domain Number 1 Region: 35-369
Classification Level Classification E-value
Superfamily L domain-like 1.02e-60
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 419-503
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-20
Family I set domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004396   Gene: ENSGGOG00000004487   Transcript: ENSGGOT00000004505
Sequence length 593
Comment pep:known_by_projection chromosome:gorGor3.1:1:130748804:130753922:-1 gene:ENSGGOG00000004487 transcript:ENSGGOT00000004505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAATAPKKAWPPWPPLLFLLLLPGGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLPL
DTELLDLSGNRLWGLQRGMLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRL
RIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLA
KLSTLTLERCNLSTVPGLALARLPALVALRLRELDIGRLPAGALQGLGQLKELEIHLWPS
LEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLSQNPISAIPARRLSPLV
RLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPL
TCDCRLLWLLRLRRRLDFGTSPPACAGPQHVQGKSLKEFSDILPPGHFTCKPALIRKSGP
RWVIAEEGGHAIFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLEDGTLEIRSVQLRDRG
AYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVGF
LPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF
Download sequence
Identical sequences G3QPA7
ENSGGOP00000004396 XP_004026715.1.27298 ENSGGOP00000004396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]