SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004403 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004403
Domain Number 1 Region: 38-112
Classification Level Classification E-value
Superfamily Histone-fold 8.09e-20
Family TBP-associated factors, TAFs 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004403   Gene: ENSGGOG00000004491   Transcript: ENSGGOT00000004513
Sequence length 117
Comment pep:known_by_projection chromosome:gorGor3.1:2a:76309710:76320480:1 gene:ENSGGOG00000004491 transcript:ENSGGOT00000004513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAG
QEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
Download sequence
Identical sequences G3QPB3 Q9NR33
ENSP00000420176 ENSP00000420176 9606.ENSP00000420176 gi|38455394|ref|NP_063949.2| ENSGGOP00000004403 ENSP00000420176 ENSGGOP00000004403 NP_063949.2.87134 NP_063949.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]