SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004414 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004414
Domain Number 1 Region: 443-577
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-38
Family C-type lectin domain 0.000000106
Further Details:      
 
Domain Number 2 Region: 587-723
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-38
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 3 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.92e-35
Family Cysteine rich domain 0.000000804
Further Details:      
 
Domain Number 4 Region: 298-436
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-31
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 834-959
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 6 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00074
Further Details:      
 
Domain Number 7 Region: 737-832
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-18
Family C-type lectin domain 0.0076
Further Details:      
 
Domain Number 8 Region: 230-287
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000332
Family C-type lectin domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004414
Domain Number - Region: 963-1007
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000155
Family C-type lectin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004414   Gene: ENSGGOG00000004499   Transcript: ENSGGOT00000004524
Sequence length 1008
Comment pep:novel chromosome:gorGor3.1:10:18488386:18582692:1 gene:ENSGGOG00000004499 transcript:ENSGGOT00000004524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLLVFASVIPGAVLLLDTRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDNLCSRGYEAMYTLLGNANGATCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDTDKLFGYCPLKFEGSESLWNKDPLTSISYQINSKSALTW
HQARKSCQQQNAELLSITEIHEQTYLTDGYWADRGCEWPLGYICKMKSRSEGPEIVEVEK
GCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKY
FWTGLSDIQTKGTFQWTIEEEVLFTHWNSDMPGRKPGCVAMRTGIAGGLWDVLKCDEKAK
FVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRA
LGGDLASINNKEEQQTIWRLITASGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYG
EPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTED
GWVTYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFI
GLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFWNDINCGYPNAFIC
QRHNSSVNATTVMPTTPLVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGG
NLVSIQNEKEQADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTAG
FIKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWLQMETSNERVWIALN
SNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYWKTAHCNESFYFLCKRSDEI
PATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRM
Download sequence
Identical sequences ENSGGOP00000004414 ENSGGOP00000004414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]