SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004431 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004431
Domain Number 1 Region: 24-142
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-18
Family V set domains (antibody variable domain-like) 0.0047
Further Details:      
 
Domain Number 2 Region: 135-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000208
Family I set domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004431   Gene: ENSGGOG00000004520   Transcript: ENSGGOT00000004541
Sequence length 317
Comment pep:known_by_projection chromosome:gorGor3.1:1:146216185:146237908:-1 gene:ENSGGOG00000004520 transcript:ENSGGOT00000004541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGIPSVVLWAVSGVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLL
LTHTERVVIWQFSNKNYIYGELYKNRVSISSNAEQSDASITIDQLTMADNGTYECSVSLM
SDLEGTTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILN
QEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVALYVGIA
VGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNRAAYEEPPEQLRELPREREEEDDYR
QEEQRSTGRESPDHLDQ
Download sequence
Identical sequences ENSGGOP00000004431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]