SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004716 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004716
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily POZ domain 1.26e-30
Family BTB/POZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 430-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004716   Gene: ENSGGOG00000004815   Transcript: ENSGGOT00000004838
Sequence length 589
Comment pep:known_by_projection chromosome:gorGor3.1:20:62003911:62053503:-1 gene:ENSGGOG00000004815 transcript:ENSGGOT00000004838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAALDISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGG
SELPSAKDSAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFL
PTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDA
LHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKC
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCS
RVFMSAASVGIRHGSRRHGVCTDCAGRGMAGPLDHGGGGGEGSPEALFPGDGPYLEDPED
PRGEAEELGEEDEGLAPEDALLADDKDEEDSPRPRSPPGGPDRDFAWLS
Download sequence
Identical sequences G3QQ58
ENSGGOP00000004716 ENSGGOP00000004716 XP_018872309.1.27298 XP_018872310.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]