SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004845 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004845
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000227
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 2 Region: 307-409
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000253
Family V set domains (antibody variable domain-like) 0.018
Further Details:      
 
Domain Number 3 Region: 449-554
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000131
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 4 Region: 168-285
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000479
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004845   Gene: ENSGGOG00000004944   Transcript: ENSGGOT00000004968
Sequence length 613
Comment pep:known_by_projection chromosome:gorGor3.1:1:139120103:139127384:-1 gene:ENSGGOG00000004944 transcript:ENSGGOT00000004968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALRPTLLPPSLPLLLLLMLGMGCWAREVLVPEGPLYRVAGTAVSISCNVTGYEGPAQQ
NFEWFLYRPEAPDTALGIVSTKDTQFSYAVFKSRVVAGEVQVQRLQGDAVVLKIARLQAQ
DAGIYECHTPSTDTRYLGSYSGKVELRVLPDVLQVSAAPPGPRGRQAPTSPPRLTVHEGQ
ELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLAA
GELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQT
LSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPAGAPGPGRLVA
QLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLR
EAASARSRPLPVHVREEGVVLEAVAWLAGGTVYRGETASLLCNISVRGGPPGLRLAASWW
VERPEDGELSSVPAQLVGGVGQDGVAELGVRPGGGPVSVELVGPRSHRLRLHSLGPEDEG
VYHCAPSAWVQHADYSWYQAGSARSGPVTVYPYMHALDTLFVPLLVGTGVALVTGATVLG
TITCCFMKRLRKR
Download sequence
Identical sequences G3QQH9 H2N555
ENSPPYP00000000750 ENSPPYP00000024589 XP_004027124.1.27298 XP_009240391.1.23681 XP_009240393.1.23681 9600.ENSPPYP00000000750 ENSGGOP00000004845 ENSGGOP00000004845 ENSPPYP00000000750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]