SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004857 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004857
Domain Number 1 Region: 40-146
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-19
Family V set domains (antibody variable domain-like) 0.00032
Further Details:      
 
Domain Number 2 Region: 383-464
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 160-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000138
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 
Domain Number 4 Region: 281-361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000956
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 461-549
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000889
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004857   Gene: ENSGGOG00000004959   Transcript: ENSGGOT00000004981
Sequence length 703
Comment pep:novel chromosome:gorGor3.1:19:47293392:47308100:-1 gene:ENSGGOG00000004959 transcript:ENSGGOT00000004981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGQAQPQSPEMLLLPLLLLPLLLPVLGAGSLNKDPSYSLQVQRQVPVPEGLCVIVSCN
LSYPRDGWDESTAAYGYWFKGRTSPKTGAPVATNNQSREVEMSTRDRFQLTGDPGKGSCS
LVIRDAQREDEAWYFFRVERGSRVRHSFVNNAFFLKVTALTQKPDVYIPETLEPGQPVTV
ICVFNWAFKKCPAPSFSWTGAALSPRRTRPSTSHFSVLSFTPSPQDHDTDLTCHVDFSRK
GVSAQRTVRLRVAYAPKDLIISISHDDTSALELQENVIYLEVQKGQFLRLLCAADSQPPA
TLSWVLQDRVLSSSHPWGPRTLGLELRGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPP
ENLRVMASQANRTDLENLGNGTSLPVLEGQSLRLVCVTHSSPPARLSWTRWGQTVGPSQP
SDPGVLELPRIQMEHEGEFTCHAQHPLGSQHVSLSLSVHYPPQLLGPSCSWEAEGLHCSC
SSQASPAPSLRWWLGEELLEGNSSQGSFEVTPSSAGPWANSSLSLHGGLSSGLRLSCEAW
NVHGAQSGSVFQLLPGKLEHGGGLGLGAALGAGVAALLAFCSCLVIFRVKTCRKEARKRA
AAEQDVPSTLGPISQGHQHECSAGSSQDHPLPGAATRTPGKGEEQELHYASLSFQGLRLW
EPADQEAPSTTEYSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
Download sequence
Identical sequences ENSGGOP00000004857 ENSGGOP00000004857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]