SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004866 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004866
Domain Number 1 Region: 27-166
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-42
Family C-type lectin domain 0.000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004866   Gene: ENSGGOG00000004968   Transcript: ENSGGOT00000004990
Sequence length 168
Comment pep:known_by_projection chromosome:gorGor3.1:2a:80544253:80547215:1 gene:ENSGGOG00000004968 transcript:ENSGGOT00000004990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDA
DQQLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSL
VSYKSWDIGAPSSVNPGYCVSLTSSTGFRKWKDVPCEDKFSFVCKFKN
Download sequence
Identical sequences ENSGGOP00000004866 ENSGGOP00000004866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]