SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004964 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004964
Domain Number 1 Region: 35-153
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000128
Family V set domains (antibody variable domain-like) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004964   Gene: ENSGGOG00000005068   Transcript: ENSGGOT00000005091
Sequence length 234
Comment pep:known_by_projection chromosome:gorGor3.1:2b:92234125:92266717:1 gene:ENSGGOG00000005068 transcript:ENSGGOT00000005091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCGLSALIMCPKGMVAVVVAVDDGDSQALAGNKILVKQSPMLVAYDNAVNLSCKYSYNL
FSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQ
TDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACY
SLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Download sequence
Identical sequences A0A2J8N5L5
ENSGGOP00000004964 XP_003820826.1.60992 XP_011510496.1.92137 XP_016805846.1.37143 XP_018877318.1.27298 ENSP00000324890 ENSP00000393648 ENSGGOP00000004964 ENSP00000393648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]