SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005029 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005029
Domain Number 1 Region: 100-203
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-19
Family C2 set domains 0.053
Further Details:      
 
Domain Number 2 Region: 199-291
Classification Level Classification E-value
Superfamily Immunoglobulin 8.12e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 6-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000643
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005029   Gene: ENSGGOG00000005133   Transcript: ENSGGOT00000005158
Sequence length 368
Comment pep:known_by_projection chromosome:gorGor3.1:1:138180744:138209779:1 gene:ENSGGOG00000005133 transcript:ENSGGOT00000005158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTP
HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATL
NCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCS
VNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKE
GSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH
AIIGGIVAFIVFLLLIMLIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGG
DDKKEYFI
Download sequence
Identical sequences ENSGGOP00000005029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]