SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005082 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005082
Domain Number 1 Region: 480-696
Classification Level Classification E-value
Superfamily CATH 1.33e-76
Family CATH 0.0019
Further Details:      
 
Domain Number 2 Region: 1841-2015
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 7.61e-61
Family Sec63 N-terminal domain 0.0000000169
Further Details:      
 
Domain Number 3 Region: 1214-1505
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.86e-56
Family Tandem AAA-ATPase domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1010-1182
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.9e-52
Family Sec63 N-terminal domain 0.00066
Further Details:      
 
Domain Number 5 Region: 477-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.6e-49
Family Tandem AAA-ATPase domain 0.00052
Further Details:      
 
Domain Number 6 Region: 676-888
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-48
Family Tandem AAA-ATPase domain 0.0017
Further Details:      
 
Domain Number 7 Region: 1514-1723
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.11e-43
Family Tandem AAA-ATPase domain 0.0015
Further Details:      
 
Domain Number 8 Region: 2016-2128
Classification Level Classification E-value
Superfamily E set domains 2.64e-32
Family Sec63 C-terminal domain-like 0.000000543
Further Details:      
 
Domain Number 9 Region: 1723-1824
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000683
Family RecQ helicase DNA-binding domain-like 0.042
Further Details:      
 
Domain Number 10 Region: 888-993
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000286
Family RecQ helicase DNA-binding domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005082   Gene: ENSGGOG00000005174   Transcript: ENSGGOT00000005213
Sequence length 2136
Comment pep:known_by_projection chromosome:gorGor3.1:2a:93763574:93803219:-1 gene:ENSGGOG00000005174 transcript:ENSGGOT00000005213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
YQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGS
HFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIY
IAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKG
GERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYED
VATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPY
GFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGR
WTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDM
LNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSL
SSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMAD
MVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVV
KKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFE
PLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESL
YQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYIT
PMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDV
AHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVI
VFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYL
HEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEI
VTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSK
CISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPI
RHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVE
SVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQ
LEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATG
AHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
Download sequence
Identical sequences A0A2K5KVL9 A0A2K5XLU4 A0A2K6N4M1 A0A2K6QI64 G3QR47 H2P548 H2QIC8 O75643
ENSPPYP00000013456 ENSP00000317123 9598.ENSPTRP00000020959 9600.ENSPPYP00000013456 9606.ENSP00000317123 3jcr_C 5o9z_C 5xjc_D 5yzg_D 5z56_D 5z57_D 5z58_D ENSPPYP00000013456 NP_054733.2.87134 NP_054733.2.92137 XP_001147672.1.37143 XP_003805775.1.60992 XP_004031465.1.27298 XP_009234447.1.23681 XP_010360379.1.97406 XP_011825042.1.47321 XP_011911145.1.92194 XP_016859092.1.92137 XP_017715958.1.44346 ENSP00000317123 ENSGGOP00000005082 gi|40217847|ref|NP_054733.2| ENSGGOP00000005082 ENSP00000317123 ENSPTRP00000020959 ENSPTRP00000020959 HR4932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]