SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005083 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005083
Domain Number 1 Region: 126-222
Classification Level Classification E-value
Superfamily Immunoglobulin 9.12e-24
Family I set domains 0.00000473
Further Details:      
 
Domain Number 2 Region: 26-124
Classification Level Classification E-value
Superfamily Immunoglobulin 2.06e-23
Family I set domains 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005083   Gene: ENSGGOG00000005189   Transcript: ENSGGOT00000005214
Sequence length 263
Comment pep:novel chromosome:gorGor3.1:19:52262692:52282604:1 gene:ENSGGOG00000005189 transcript:ENSGGOT00000005214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMVVSMACVGLFLLQGAWPHEVVHRKLSLLAYPGPLVKSEETVILQCRSDVMFEHFLL
HREGKFNDTLSLTGELHDGVSKANFSIGPMTPALAGTYRCYGSVPHCPFERSAPSDPLDI
MITGLYEKPSLSAQPGPTVLAGESVTLSCSSRRSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHVSPYEWSNPSDPLLVSVTGNSSSSSSSPTEPSSKTEM
EFHHVAQCLQLPTSSDPTVSASQ
Download sequence
Identical sequences ENSGGOP00000005083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]