SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005164 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005164
Domain Number 1 Region: 142-234
Classification Level Classification E-value
Superfamily Fibronectin type III 6e-24
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 259-351
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-20
Family I set domains 0.0053
Further Details:      
 
Domain Number 3 Region: 61-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000333
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005164   Gene: ENSGGOG00000005271   Transcript: ENSGGOT00000005298
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:1:112131636:112146184:-1 gene:ENSGGOG00000005271 transcript:ENSGGOT00000005298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRTLR
QTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGERDSILFIREAQRADS
GRYQLRVQLGGLEATATIDILVIERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGY
TVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHI
QKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMD
IQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN
Download sequence
Identical sequences G3QRC1
ENSGGOP00000005164 ENSGGOP00000005164 XP_018867158.1.27298 XP_018867208.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]