SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005224 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005224
Domain Number 1 Region: 143-228
Classification Level Classification E-value
Superfamily Immunoglobulin 4.45e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 31-140
Classification Level Classification E-value
Superfamily Immunoglobulin 8.22e-16
Family V set domains (antibody variable domain-like) 0.00026
Further Details:      
 
Domain Number 3 Region: 252-334
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000168
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005224   Gene: ENSGGOG00000005332   Transcript: ENSGGOT00000005360
Sequence length 450
Comment pep:known_by_projection chromosome:gorGor3.1:19:48864638:48876929:-1 gene:ENSGGOG00000005332 transcript:ENSGGOT00000005360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSSGSLASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYY
GYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDYRRKNCSLSIRDARRRDNAAYFFR
LKYKWMKYGYTSSKLSVHVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSW
MSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVA
ISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTG
VLELPQVGSAEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLC
VCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGPRGHQHQFRTGIVSDHPAEAGPISEDEQE
LHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Download sequence
Identical sequences ENSGGOP00000005224 ENSGGOP00000005224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]