SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005368 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005368
Domain Number 1 Region: 21-100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-20
Family V set domains (antibody variable domain-like) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005368   Gene: ENSGGOG00000005483   Transcript: ENSGGOT00000005509
Sequence length 100
Comment pep:known_by_projection chromosome:gorGor3.1:8:44977849:44978253:-1 gene:ENSGGOG00000005483 transcript:ENSGGOT00000005509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACMMLLLGLLAYGSGVDSQSVVTQEPSLSGSPGGTVTLTCALSSGSVSTSHYPSWYQRT
PGQAPHMLICSPNTCPSGVPGRFSGSILGNKAALTITGTQ
Download sequence
Identical sequences ENSGGOP00000005368 ENSGGOP00000005368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]