SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005398 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005398
Domain Number 1 Region: 186-249
Classification Level Classification E-value
Superfamily RILP dimerisation region 1.57e-17
Family RILP dimerisation region 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005398   Gene: ENSGGOG00000005513   Transcript: ENSGGOT00000005540
Sequence length 343
Comment pep:known_by_projection chromosome:gorGor3.1:17:1588308:1591734:-1 gene:ENSGGOG00000005513 transcript:ENSGGOT00000005540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRAAPGAPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVR
ALELLERAAVGPAPDSRQRGQETEALQEQLQRLLLVNAELRHKLAAVQTQLRAAQDRERE
RQQPGEAATPQAKERARGQAGRPGHQHGQEPEWATAGAGAPGNPEDPAEAAQQLGRPSEA
GQCRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQR
KKIKAKMLGTPEEAESSEDEAGPWLLLSHDEGDHPPPPESKIQSFFGLWYQGKAESSEDE
TSSPAPSKLGGEEEAQPQSPAPDPPCSAVHEHLCLGASAAPEA
Download sequence
Identical sequences G3QRY1
ENSGGOP00000005398 ENSGGOP00000005398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]