SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005457 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005457
Domain Number 1 Region: 145-235
Classification Level Classification E-value
Superfamily Immunoglobulin 4.26e-17
Family C1 set domains (antibody constant domain-like) 0.02
Further Details:      
 
Domain Number 2 Region: 33-142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000475
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005457   Gene: ENSGGOG00000005571   Transcript: ENSGGOT00000005601
Sequence length 276
Comment pep:known_by_projection chromosome:gorGor3.1:20:1651524:1683742:-1 gene:ENSGGOG00000005571 transcript:ENSGGOT00000005601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
VGPVLWFRGIGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
TANLSEAIRGPASSLTALLLIAILLGPIYIPWKQKT
Download sequence
Identical sequences G3QS34
XP_004061722.1.27298 ENSGGOP00000005457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]