SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005461 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000005461
Domain Number - Region: 24-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0426
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005461   Gene: ENSGGOG00000005575   Transcript: ENSGGOT00000005605
Sequence length 241
Comment pep:known_by_projection chromosome:gorGor3.1:6:32617798:32619534:1 gene:ENSGGOG00000005575 transcript:ENSGGOT00000005605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCVGVSHPIRWVWAPSFPACKGLSKGR
RPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVL
HVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF
APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVV
V
Download sequence
Identical sequences XP_004043747.1.27298 ENSGGOP00000005461 ENSGGOP00000005461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]