SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005472 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005472
Domain Number 1 Region: 636-830
Classification Level Classification E-value
Superfamily Fibronectin type III 7.74e-38
Family Fibronectin type III 0.00000437
Further Details:      
 
Domain Number 2 Region: 1045-1136
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-23
Family I set domains 0.0037
Further Details:      
 
Domain Number 3 Region: 927-1016
Classification Level Classification E-value
Superfamily Fibronectin type III 1.07e-20
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 553-642
Classification Level Classification E-value
Superfamily Immunoglobulin 6.49e-19
Family I set domains 0.00075
Further Details:      
 
Domain Number 5 Region: 440-514
Classification Level Classification E-value
Superfamily Immunoglobulin 2.98e-16
Family I set domains 0.0081
Further Details:      
 
Domain Number 6 Region: 54-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000021
Family I set domains 0.00034
Further Details:      
 
Domain Number 7 Region: 258-351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000357
Family I set domains 0.00015
Further Details:      
 
Domain Number 8 Region: 340-432
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000192
Family I set domains 0.0012
Further Details:      
 
Domain Number 9 Region: 847-937
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000228
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005472   Gene: ENSGGOG00000005580   Transcript: ENSGGOT00000005616
Sequence length 1137
Comment pep:known_by_projection chromosome:gorGor3.1:19:47784159:47819318:1 gene:ENSGGOG00000005580 transcript:ENSGGOT00000005616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDS
VSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHDSASNVYTVE
LHIGKVVLGDRGDYRLEVKAKDACDSCGFNIDVEAPRQDASGQSLESFKRTGEKKSDTAG
ELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRG
MLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLPLKWFKNGQEIKPSS
KYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVG
DRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQ
VITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRP
SKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLGPRISSVPPEPPKI
HLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCS
SFVIESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEP
PMYDGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGV
SQPSMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSE
EWVPANTEPVERCGFTVKNLPTGAKILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIR
LPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQ
AARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGN
SEITGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVS
KNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVW
MKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVR
Download sequence
Identical sequences ENSGGOP00000005472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]