SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005487 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005487
Domain Number 1 Region: 359-438
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000174
Family C2 set domains 0.017
Further Details:      
 
Domain Number 2 Region: 256-354
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000394
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 
Domain Number 3 Region: 52-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000137
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 
Domain Number 4 Region: 155-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000167
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005487   Gene: ENSGGOG00000005605   Transcript: ENSGGOT00000005631
Sequence length 656
Comment pep:known_by_projection chromosome:gorGor3.1:1:139869347:139903173:1 gene:ENSGGOG00000005605 transcript:ENSGGOT00000005631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILG
GSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISN
LTLNDAGSYKAQINQRNFEVTTDEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSV
KGAEKSVLYSWTPRDPHASQSNGGSILTVSRTPCDPDLPYTCTAQNPVSQRSSLPVHIGQ
FCTDPGASRGGTTGKTVVGVLGETVTLPLALPACRDTEKVVWLFNTSIISKEREEAATAD
PLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMTHVTLLIYRRL
RKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSE
NHPNLTCTASNPVSNSSHQFLSENICSGPERNTKLWIGLFLMVCLLCIGIFSWCIWKRKG
RCSVPAFCSSQAEAPVDTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSN
LTTEEDEDRPEVHKPISGRDEVYDQVTQEGAGHDPAPEGQADYDPITPYVTEVESVVGEN
TVYAQVFNLQGKTPVSQKEESSATIYCSIWKPQVVVPPPQQNDLEIPESPTYENFT
Download sequence
Identical sequences ENSGGOP00000005487 ENSGGOP00000005487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]