SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005494 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005494
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000408
Family I set domains 0.095
Further Details:      
 
Domain Number 2 Region: 152-215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000159
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005494   Gene: ENSGGOG00000005612   Transcript: ENSGGOT00000005638
Sequence length 370
Comment pep:known_by_projection chromosome:gorGor3.1:1:139905091:139937828:-1 gene:ENSGGOG00000005612 transcript:ENSGGOT00000005638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGQEVTLVLLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDNIAWKKLLPSQ
NEFHQILKWENGSLPYNTSNDRFSFTVENLSLLIKAAQQQDSGLYCLEVTSISGKVQTAK
FQVFVFESLLPDKVEKPRLRGQGKILDRGRCQVALSCLVSRDGNMTYAWYRGSKLIQTAG
NLTFLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSTL
FLGTLACFCVRRRKRKGKQSETSPKEFLTIYEDVKDLKTRRNQEQEQTFPGAGSTIYSMI
QSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSR
KELENFDVYS
Download sequence
Identical sequences ENSGGOP00000005494 ENSGGOP00000005494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]