SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005587 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005587
Domain Number 1 Region: 267-359
Classification Level Classification E-value
Superfamily Immunoglobulin 4.33e-26
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 434-534
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-24
Family I set domains 0.0048
Further Details:      
 
Domain Number 3 Region: 946-1041
Classification Level Classification E-value
Superfamily Immunoglobulin 5.34e-24
Family I set domains 0.0016
Further Details:      
 
Domain Number 4 Region: 1071-1166
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.008
Further Details:      
 
Domain Number 5 Region: 1170-1265
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-21
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005587   Gene: ENSGGOG00000005699   Transcript: ENSGGOT00000005732
Sequence length 1321
Comment pep:known_by_projection chromosome:gorGor3.1:10:80554200:80659720:1 gene:ENSGGOG00000005699 transcript:ENSGGOT00000005732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDDSIEASTSISQLLRESYLAETRHRGNNERSRAEPSSNPCHFGSPSGAAEGGGGQDDL
PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQTKHSPNLSFEPNFCQD
NPRSPTSPKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSSKRIRPRACKN
HKSKLESQNKVMQENSSSFSDLSERRERSSVPIPIPADTRDNEVNHALEQQEAKRREAEQ
AASEAAGGDTTPGSSPSSLYYEEPLGQPPRFTQKLRSREVPEGTRVQLDCIVVGIPPPQV
RWYCEGKELENSPDIHIVQAGNLHSLTIAEAFEEDTGRYSCFASNIYGTDSTSAEIYIEG
VSSSDSEGDPNKEEMNRRIQKPNEVSSPPTTSAAIPPAVSQAQHLVAQPRVATIQQCQSP
TNYLQGLDGKPIIAAPVFTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYREGTLIEDSP
DFRILQKKPRSMAEPEEICTLVIAEVFAEDSGCFTCTASNKYGTVSSIAQLHVRGNEDLS
NNGSLHSANSTTNLAAIEPQPSPPHSEPPSVEQPPKPKLEGVLVNHNEPRSSSRIGLRVH
FNLPEDDKGSEASSEAGVVTTRQTRPNSFQERFNGQATKTPEPSSPVKEPPPVLAKPKLD
STQLQQLHNQVLLEQHQLQNPPPSSPKEFPFNMTVLNSTAPPAVTTSSKQVKAPSSQTFS
LARPKYFFPSTNTTAATVAPSSSPVFTLSSTPQTIQRTVSKESLLVSHPSVQTKSPGGLS
IQNEPLPPGPTEPTPPPFTFSIPSGNQFQPRCVSPTPVSPTSRIQNPVAFLSSVLPSLPA
IPPTNAMGLPRSAPSMPSQGLVKKNTKCPQPVNDDNIRETKNAVIRDLGKKITFSDVRPN
QQEYKISSFEQRLMNEIEFRLERTPVDESDDEIQHDEIPTGKCIAPIFDKRLKHFRVTEG
SPVTFTCKIVGIPVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTI
MAANPQGRISCSGHLMVQSLPIRSRLTSAGQSHRGRSRVQERDKEPLQERFFRPHFLQAP
GDMVAHEGRLCRLDCKVSGLPPPELTWLLNGQPVLPDASHKMLVRETGVHSLLIDPLTQR
DAGTYKCIATNKTGQNSFSLELSVVAKEVKKAPVILEKLQNCGVPEGHPVRLECRVIGMP
PPVFYWKKDNETIPCTRERISMHQDTTGYACLLIQPAKKSDAGWYTLSAKNEAGIVSCTA
RLDIYAQWHHQIPPPMSVRPSGSRYGSLTSKGLDIFSAFSSMESTMVYSCSSRSVVESDE
L
Download sequence
Identical sequences ENSGGOP00000005587 ENSGGOP00000005587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]