SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005612 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005612
Domain Number 1 Region: 307-411
Classification Level Classification E-value
Superfamily Immunoglobulin 8.08e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 119-223
Classification Level Classification E-value
Superfamily Immunoglobulin 2.31e-17
Family C1 set domains (antibody constant domain-like) 0.024
Further Details:      
 
Domain Number 3 Region: 22-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000365
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 
Domain Number 4 Region: 219-304
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000846
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 408-503
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000381
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005612   Gene: ENSGGOG00000005728   Transcript: ENSGGOT00000005757
Sequence length 773
Comment pep:known_by_projection chromosome:gorGor3.1:1:136992620:137095008:1 gene:ENSGGOG00000005728 transcript:ENSGGOT00000005757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLAL
GMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPP
EDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRET
TVSQLLINPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERV
VFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVST
LVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAA
LSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAV
RGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEA
DFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGATIGASILLIFFFIALVFFLYRRR
KGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTTSVSTATRVMKAIYSSFKDDVDLKQD
LRCDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHS
SGYAQLNTYSRAPASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTY
RLGYPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV
Download sequence
Identical sequences ENSGGOP00000005612 ENSGGOP00000005612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]