SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005639 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005639
Domain Number 1 Region: 34-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.55e-40
Family Frizzled cysteine-rich domain 0.000000217
Further Details:      
 
Domain Number 2 Region: 178-289
Classification Level Classification E-value
Superfamily TIMP-like 1.88e-26
Family Tissue inhibitor of metalloproteinases, TIMP 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005639   Gene: ENSGGOG00000005758   Transcript: ENSGGOT00000005786
Sequence length 325
Comment pep:known_by_projection chromosome:gorGor3.1:2b:70894978:70927667:-1 gene:ENSGGOG00000005758 transcript:ENSGGOT00000005786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSSPGGMLLLRAGLLALAALCLLQVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
KPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTS
SGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSK
SDSSNSDSTQSQKSGRNSNPRQARN
Download sequence
Identical sequences G3QSJ7
ENSGGOP00000005639 ENSGGOP00000005639 XP_004032965.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]