SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005668 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005668
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000019
Family Ankyrin repeat 0.004
Further Details:      
 
Domain Number 2 Region: 282-331
Classification Level Classification E-value
Superfamily LEM domain 0.0000000053
Family LEM domain 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005668
Domain Number - Region: 153-212
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 0.000777
Family AglA-like glucosidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005668   Gene: ENSGGOG00000005788   Transcript: ENSGGOT00000005817
Sequence length 544
Comment pep:known_by_projection chromosome:gorGor3.1:19:17622632:17627710:1 gene:ENSGGOG00000005788 transcript:ENSGGOT00000005817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSVEALTPLHVAAAWGCRRGLELLLSQGGDPALRDQDGLRPLDLALQQGHLECARVLQDL
DTRTGTRTRIGAETQEPEPAPGTPGLSGPPNETLDSIALQKQPCRGDNRDIGLEADPGPP
SLPVPLEIVDKHGSSASPPGYWDYSSDASFVTAVEVSGAEDPASDTPPWAGSLPPTRQGL
LHVVHANQRVPRSQGTEAELNARLQALTLTPPNAAGFQSSPSSMPLLDRSPAHSPPRTPP
PGASDCHCLWEHQTSIDSDMATLWLTEDEASSTGGRDPVGPCRHLPVSTVSDLELLKGLR
ALGENPRPVTPFTGQFYLQQLEEAQIAPGPEFSGHSLELAVALRTGRIPDVQADEDALAQ
QFERPDPARRWREGVVKSSFTYLLLDPRETQDLPARAFSLTPAERLQTFIRAIFYVGKGT
RARPYVHLWEALGHHGQSRKQPPQACPKVRQILDIWASGCGVVSLHCFQHVVAVEAYTRE
ACIVEALGIQTLTNQKQGHCYGVVAGWPPARRRRLGVHLLHRALLVFLAEGERQLRPQDI
QARG
Download sequence
Identical sequences ENSGGOP00000005668 ENSGGOP00000005668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]