SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005682 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005682
Domain Number 1 Region: 149-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000339
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 41-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000157
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005682   Gene: ENSGGOG00000005800   Transcript: ENSGGOT00000005831
Sequence length 390
Comment pep:known_by_projection chromosome:gorGor3.1:11:122921863:122931099:-1 gene:ENSGGOG00000005800 transcript:ENSGGOT00000005831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEV
SSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKD
SGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPRVGANVTLSCQSPRSK
PAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLE
VSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRAKALEEPANDIKEDAIAPRTLPWPKS
SDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISP
IPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
Download sequence
Identical sequences G3QSP0
XP_004052395.1.27298 ENSGGOP00000005682 ENSGGOP00000005682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]