SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005733 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005733
Domain Number 1 Region: 313-378
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000031
Family PHD domain 0.0049
Further Details:      
 
Domain Number 2 Region: 191-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000151
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 269-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000532
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005733   Gene: ENSGGOG00000005852   Transcript: ENSGGOT00000005883
Sequence length 386
Comment pep:known_by_projection chromosome:gorGor3.1:19:35584030:35599583:-1 gene:ENSGGOG00000005852 transcript:ENSGGOT00000005883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTH
RGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEAL
LCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLR
KRQDTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNN
HKQFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSG
HPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDSDRGYHMYCLSPPMAE
PPEGSWSCHLCLRHLKEKASAYITLT
Download sequence
Identical sequences ENSGGOP00000005733 ENSGGOP00000005733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]