SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005802 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005802
Domain Number 1 Region: 32-143
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 8.24e-42
Family Frizzled cysteine-rich domain 0.000000753
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005802
Domain Number - Region: 221-527
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00824
Family Rhodopsin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005802   Gene: ENSGGOG00000005930   Transcript: ENSGGOT00000005957
Sequence length 585
Comment pep:known_by_projection chromosome:gorGor3.1:2b:96411333:96418144:-1 gene:ENSGGOG00000005930 transcript:ENSGGOT00000005957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGG
ECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGHDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPSATYHKQVSLSHV
Download sequence
Identical sequences A0A2I2YRF3
ENSGGOP00000005802 XP_004033172.1.27298 ENSGGOP00000005802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]