SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005808 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005808
Domain Number 1 Region: 26-120
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-17
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 2 Region: 138-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000152
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005808   Gene: ENSGGOG00000005931   Transcript: ENSGGOT00000005963
Sequence length 393
Comment pep:known_by_projection chromosome:gorGor3.1:11:116119530:116140070:-1 gene:ENSGGOG00000005931 transcript:ENSGGOT00000005963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLS
PGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRL
KGESQVFKKAVVLHVLPEEPKELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEE
IVFRYYHKLRMSAEYSQSWGHFQNRVNLVGDIFHNDGSIMLQGVRESDGGNYTCSIHLGN
LVFKKTIVLHVSPEEPRTLVTPIALRPLVLGGNQLVIIVGIVCATILLLPVLILIVKKTC
GNRSSVNSTVLVKNTKKTNPEIKEKPCDFERCEGEKHIYSPIIVREVIEEEEPSEKSEAT
YMTMHPVWPSLRSDQNNSLEKKSGGGMPKTQAF
Download sequence
Identical sequences G3QT04
ENSGGOP00000005808 ENSGGOP00000005808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]