SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005837 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005837
Domain Number 1 Region: 606-810
Classification Level Classification E-value
Superfamily Fibronectin type III 8.74e-34
Family Fibronectin type III 0.00000295
Further Details:      
 
Domain Number 2 Region: 316-407
Classification Level Classification E-value
Superfamily Immunoglobulin 2.61e-22
Family I set domains 0.0061
Further Details:      
 
Domain Number 3 Region: 237-326
Classification Level Classification E-value
Superfamily Immunoglobulin 4.68e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 36-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000222
Family I set domains 0.024
Further Details:      
 
Domain Number 5 Region: 468-574
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000257
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 6 Region: 136-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000026
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005837   Gene: ENSGGOG00000005957   Transcript: ENSGGOT00000005994
Sequence length 1115
Comment pep:known_by_projection chromosome:gorGor3.1:3:112537053:112612657:1 gene:ENSGGOG00000005957 transcript:ENSGGOT00000005994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCLVE
PPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPA
TVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCM
ADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
VPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD
AELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVRPASPQCPGEKGQGAPAEAPIILSS
PRTSKTDSYELVWRPRHEGSGRAPILYYVVKHRKQVTNSSDDWTISGIPANQHHLTLTRL
DPGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPD
HGRLSPPEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAI
PPSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYIT
FTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISH
LQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPPPETIER
PVGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPP
SCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPAAAVGYPGMKPQQHCPGE
LQQQSDTSSLLRQTHLGNGYDPQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCC
QRQEQPAAVGQSGVRRAPNSPVLEAVWDPPFHSGPPCCLGLVPVEEVDSPDSCQVSGGDW
CPQHPVEAYVGQEPGMQLSPGPPARVSFETPPLTI
Download sequence
Identical sequences ENSGGOP00000005837 ENSGGOP00000005837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]