SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005852 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005852
Domain Number 1 Region: 28-109
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-26
Family I set domains 0.0000142
Further Details:      
 
Domain Number 2 Region: 213-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-24
Family I set domains 0.00000603
Further Details:      
 
Domain Number 3 Region: 109-203
Classification Level Classification E-value
Superfamily Immunoglobulin 4.55e-21
Family C2 set domains 0.00000345
Further Details:      
 
Domain Number 4 Region: 392-479
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000372
Family I set domains 0.00022
Further Details:      
 
Domain Number 5 Region: 310-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000838
Family C2 set domains 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005852   Gene: ENSGGOG00000005980   Transcript: ENSGGOT00000006009
Sequence length 532
Comment pep:known chromosome:gorGor3.1:19:10457934:10633521:1 gene:ENSGGOG00000005980 transcript:ENSGGOT00000006009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPPKVILPRGGSVLVTCSTSCDQPTLLGI
ETPLPKKELLLLGNNQKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKDLTLRCQVEGGAPRANLIVVLLRGEEELKREPAVGEPAEVTTTVPVEKDHH
GANFLCRTELDLRPQGLKLFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQWLTCAVILGTQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPPGPRTQFLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPVGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYE
FVIIAVVAAAVIMGTAGLSTYLYNRQRKIRKYRLQQAQKGTPMKPNTQATPP
Download sequence
Identical sequences Q5NKV9
ENSGGOP00000005852 NP_001266532.1.27298 ENSGGOP00000005852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]