SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005864 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005864
Domain Number 1 Region: 291-383
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-18
Family I set domains 0.035
Further Details:      
 
Domain Number 2 Region: 143-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 3 Region: 211-272
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000294
Family Pre-dockerin domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005864
Domain Number - Region: 473-526
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00322
Family Carboxypeptidase regulatory domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005864   Gene: ENSGGOG00000005993   Transcript: ENSGGOT00000006021
Sequence length 1156
Comment pep:known_by_projection chromosome:gorGor3.1:19:19918122:19926523:1 gene:ENSGGOG00000005993 transcript:ENSGGOT00000006021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLPLLCLCVVAAHLAGARDATPTEEPMATALGLERRSVYPGQPSPALEDWEEASEWT
SWFNVDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWALPSAVGERVHLNPTRG
FWCLNREQPRGRRCSNYHVRFRCPLEASWGAWGPWGPCSGSCGPGRRLRRRHCPSPAGDA
CPGRPLEAQKCVRPRCPGCSLDTCECPRHILLGSVVTPSGQPLLGARVSLRDQPGTVATS
DAHGTFRVPGVCADSRANIRAQMDGFSAGEAQAQANGSISVVTIILDKLEKPYLVKHPES
RVREAGQNVTFCCKASGTPMPKKYSWFHNGTLLDRQAHGYGAHLELRGLRPDQAGIYHCK
AWNEAGAVRSGTARLTVLAPGQPACDPRPREYLIKLPEDCGQPGSGPAYLDVGLCPDTRC
PSLAGSSPRCGDASSRCCSVRRLERREIHCPGYVLPVKVVAECGCQKCLPPRGLVRGRIV
AADSGEPLRFARILLGREPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPF
DPRGAGVYHEVKAMRKKAPVILHASQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYS
GPVEARVTFVDPRDLTSAASAPSDLRFVDSDGELAPLRTYGMFSVDLRAPGSAEQLQVGP
VAVRVAASQIHMPGHVEALKLWSLNPETGLWEEESGFRREGSSGPRVRREERVFLVGNVE
IRERRLFNLDVPERRRCFVKVRAYANDKFTPSEQVEGVVVTLVNLEPAPGFSVNPRAWGR
FDSAVTGPNGACLPAFCDADRPDAYTALVTATLGGEELEPAPSLPRPLPATVGVTQPYLD
RLGYRRTDHDDPAFKRNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTASHFRFA
RVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGG
SHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRR
VAVNGLLRDYLTRHPPLVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRC
FDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEVAQAQ
ARASGPLRTRRGRVRQ
Download sequence
Identical sequences XP_004060426.1.27298 ENSGGOP00000005864 ENSGGOP00000005864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]