SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005865 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005865
Domain Number 1 Region: 200-295
Classification Level Classification E-value
Superfamily Immunoglobulin 4.4e-26
Family I set domains 0.00023
Further Details:      
 
Domain Number 2 Region: 91-189
Classification Level Classification E-value
Superfamily Immunoglobulin 2.98e-23
Family C2 set domains 0.00011
Further Details:      
 
Domain Number 3 Region: 6-92
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-23
Family I set domains 0.0062
Further Details:      
 
Domain Number 4 Region: 710-808
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000787
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 472-549
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000832
Family I set domains 0.021
Further Details:      
 
Domain Number 6 Region: 541-619,664-716
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000143
Family I set domains 0.0048
Further Details:      
 
Domain Number 7 Region: 378-473
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000108
Family I set domains 0.0015
Further Details:      
 
Domain Number 8 Region: 296-378
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000836
Family C2 set domains 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005865   Gene: ENSGGOG00000005992   Transcript: ENSGGOT00000006022
Sequence length 898
Comment pep:known_by_projection chromosome:gorGor3.1:19:10304768:10493747:1 gene:ENSGGOG00000005992 transcript:ENSGGOT00000006022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQ
LVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELMPLPPWQPVGENFTLSCRVPG
AGPRASLTLTLLRGAQELIRRSFAGEPPRARGAVLTATVLARREDHGANFSCRAELDLRP
HGLGLFENSSAPRELRTFSLSPDPPRLAAPRLLEVGSERPVSCTLDGLFPASEARVYLAL
GDQNLSPDVTLEGDAFVATATATASAEQEGARQLVCNVTLGGENRETRENVTIYSFPAPL
LTLSEPSVSEGQMVTVTCAAGAQALVTLEGVPAAVPGQPAQLQLNATENDDRRSFFCDAT
LDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWTWPEGPEQTLRCEARGNPEPSVHCARS
DGGAVLALGLLGPVTRALSGTYRCKAANDQGEAVKDVTLTVEYAPALDSVGCPERITWLE
GTEASLSCVAHGVPPPDVICVRSGELGAVIEGLLRVAREHAGTYRCEATNPRGSAAKNVA
VTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDGKPQPSVKCVGSGGATEGVLLPLAPPD
PSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVVSAESPPEMDESTCPSHQTWLEGAEAS
ALACAARGRPSPGVRCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRP
VVAELAASPPGGVRPGGNFTLTCRAEAWPPAQISWRAPPGALNIGLSSNNSTLSVAGAMG
SHGGEYECAATNAHGRHARRITVRVAGPWLWVAVGGAAGGAALLAAGAGLAFYVQSTACK
KGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGGPEAAGGAAESPAEGEVFAIQLTSA
Download sequence
Identical sequences ENSGGOP00000005865 ENSGGOP00000005865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]