SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005895 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005895
Domain Number 1 Region: 30-115
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-26
Family I set domains 0.0022
Further Details:      
 
Domain Number 2 Region: 217-312
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-23
Family I set domains 0.00024
Further Details:      
 
Domain Number 3 Region: 113-208
Classification Level Classification E-value
Superfamily Immunoglobulin 4.84e-21
Family C2 set domains 0.000015
Further Details:      
 
Domain Number 4 Region: 317-396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000497
Family C2 set domains 0.0008
Further Details:      
 
Domain Number 5 Region: 396-480
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000666
Family I set domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005895   Gene: ENSGGOG00000006021   Transcript: ENSGGOT00000006052
Sequence length 547
Comment pep:known_by_projection chromosome:gorGor3.1:19:10531418:10540022:-1 gene:ENSGGOG00000006021 transcript:ENSGGOT00000006052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVPSVLWPGACWTLLLCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSS
EKIALETSLSKELVASGMGWAAFNLSNVTGNSRIFCSVYCNGSQITGSSNITVYRLPERV
ELAPLPPWQPVGQNFTLRCQVEGGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTAPVLAS
RGDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPMTPPRLVAPRFLEVETSWPVD
CTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATATALADQEGAREIVCNVTLGG
ERREARENLTIFSFLGPIVNLSEPTAPEGSTVTVSCMAGARVQVTLDGVPAAAPGQPAQL
QLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTTHV
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIE
AGSSHFVPVFVAVLLTLGVVTIVLALMYVFREHKRSGSYHVREESTYLPLTSMQPTEAMG
EEPSRAE
Download sequence
Identical sequences ENSGGOP00000005895 ENSGGOP00000005895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]