SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005923 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005923
Domain Number 1 Region: 111-204
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-27
Family I set domains 0.00058
Further Details:      
 
Domain Number 2 Region: 25-109
Classification Level Classification E-value
Superfamily Immunoglobulin 3.97e-18
Family I set domains 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005923
Domain Number - Region: 164-197,343-413
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 0.0785
Family TolB, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005923   Gene: ENSGGOG00000006054   Transcript: ENSGGOT00000006081
Sequence length 598
Comment pep:known_by_projection chromosome:gorGor3.1:19:52507302:52536001:-1 gene:ENSGGOG00000006054 transcript:ENSGGOT00000006081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSPTALFYLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE
KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELIATGVFAKPSLSAQP
GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC
YSFSSRDPYLWSAPSDPLELVVTGSSVTPSRLPTEPPSSVAETSRSITASPKESDFPAGE
SCPPVLHQGQPGPDMPRGGDPNTPGGVSGRGLAQPEKAPAAQGQGCAETASAPPAPPADP
EITRGSGWRPTGCSQPRVMFMTTAPQARSYPRDRSWHGRRLKDWRVWSVEAGGQRLQLWK
RGHDASSWCSIREPFSQCLSVCLLLCLRAPSIWDGRNLWRPHPPPCTWMTWYPGWTTYWP
LSSISLIWAPDGSLRFPALRVDSVPSSVQNPPVLPLGPLCSCLVFPRNSHPHSIFHCGLT
NLLSSLRTGLAGSLGVSFIFLSVKLAPCPLPFTLEKKISLCNMVKPHLYQKNKKQKLARC
GGASLYSQQLRGLRWENGLSVGGRCCSELRSHHCTLAWVTKPDLVSKNKGMNMLITLI
Download sequence
Identical sequences ENSGGOP00000005923 ENSGGOP00000005923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]