SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005950 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005950
Domain Number 1 Region: 43-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 251-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000144
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 454-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 210-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000107
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 415-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005950
Domain Number - Region: 366-413
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00233
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005950   Gene: ENSGGOG00000006079   Transcript: ENSGGOT00000006108
Sequence length 758
Comment pep:known_by_projection chromosome:gorGor3.1:19:30411870:30422852:1 gene:ENSGGOG00000006079 transcript:ENSGGOT00000006108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSGAAAGPQQVCGIPDPFFVSPTVNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSSSDSDGGSPGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHALWNRLF
HRPRAPRGQIPLLTAARPSQTVLGDGFLQPAPGAAPDPPAPLMDTGSTRAAGDRPPSAPG
RAPEVGPSGPPLPSGLRDPECRPVDKDRKVCREPLADGPAPADAPREPCSAQDPHPQAST
ASSTLGPHSPEPLGVCRNPPPTCSPMLEASDDEALLVC
Download sequence
Identical sequences ENSGGOP00000005950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]