SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006054 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006054
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.44e-97
Family Carbonic anhydrase 0.0000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006054   Gene: ENSGGOG00000006188   Transcript: ENSGGOT00000006216
Sequence length 262
Comment pep:known_by_projection chromosome:gorGor3.1:8:83669034:83709006:1 gene:ENSGGOG00000006188 transcript:ENSGGOT00000006216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGRQTRFTNF
DPLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Download sequence
Identical sequences G3QTM5
XP_004047266.1.27298 ENSGGOP00000006054 ENSGGOP00000006054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]