SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006102 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006102
Domain Number 1 Region: 98-142
Classification Level Classification E-value
Superfamily LysM domain 0.0000000105
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006102   Gene: ENSGGOG00000006236   Transcript: ENSGGOT00000006266
Sequence length 846
Comment pep:known_by_projection chromosome:gorGor3.1:8:105586215:106085666:1 gene:ENSGGOG00000006236 transcript:ENSGGOT00000006266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSNLSWLKKKSQSVDINAPGFNPLAGAGKQTPQASKPPAPKTPIIEEEQNNAANTQKH
PSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTMNPDVH
PTEATPSSTFTGIQPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIM
FDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDIDQLSGRDFCHS
KKMTGSNTEDIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQD
KSSGASSESVQTVNQTEVESLTVKSESTGTPGHLRSDTEHSTNEVGTLCHKTDLNNLEMA
IKEDQIADNFQGISGPKEDSTSIKGNSDQDSFLHENSLHQEESQKENMPCGETAEFKQKQ
SVNKGKQGKEQNQDSQREVEELRKLWKTHTMQQTKQQRENIQQVSQKEAKHKITSADGHI
ESSALLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTD
HLYAFFIQWSPEIYAEDTGEYTREPGFIVVKKIEESETIEDSSNQAAAREWEITTREDIN
SKQVAPVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTS
LKTLYRSMTGLDTPVLMVIKDSDGQVFGALASEALKVSDGFYGTGETFVFTFCPEFEVFK
WTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDI
EIWAFE
Download sequence
Identical sequences ENSGGOP00000006102 XP_018887824.1.27298 ENSGGOP00000006102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]