SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006108 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006108
Domain Number 1 Region: 21-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000262
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006108   Gene: ENSGGOG00000006247   Transcript: ENSGGOT00000006272
Sequence length 205
Comment pep:known_by_projection chromosome:gorGor3.1:6:14736606:14756426:1 gene:ENSGGOG00000006247 transcript:ENSGGOT00000006272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLEPVTPHKTELV
Download sequence
Identical sequences G3QTS5
ENSGGOP00000006108 ENSGGOP00000006108 XP_004043350.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]