SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006172 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006172
Domain Number 1 Region: 1687-1969
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000112
Further Details:      
 
Domain Number 2 Region: 108-201
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000129
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 734-813
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000481
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 822-902
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000122
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 5 Region: 465-546
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000106
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 6 Region: 287-366
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000107
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 7 Region: 1176-1256
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000159
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 8 Region: 911-989
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000213
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 9 Region: 1088-1168
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000023
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 10 Region: 1357-1462
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000396
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 11 Region: 647-727
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000001
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 12 Region: 998-1089
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000108
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 13 Region: 552-642
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000697
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 14 Region: 203-277
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000273
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 15 Region: 1265-1354
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000817
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 16 Region: 375-456
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000386
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 17 Region: 34-99
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000196
Family Fibronectin type III 0.009
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006172
Domain Number - Region: 1454-1512,1565-1595
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000164
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006172   Gene: ENSGGOG00000006298   Transcript: ENSGGOT00000006338
Sequence length 2003
Comment pep:known_by_projection chromosome:gorGor3.1:12:69003710:69096688:-1 gene:ENSGGOG00000006298 transcript:ENSGGOT00000006338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSHGAGLALWITLSLLQTGLAEPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSS
DTLGAALCPIFRIDNTTYGCNLQDLQAGTIYNFKIISLDEERTVVLQTDPLPPARFGVSK
EKTTSTSLHVWWTPSSGKVTSYEVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYN
IAITAVSGGKRSSSVYTNGSTVVPSPVKDIGISTKANSLLISWSHGSGNVERYRLMLMDK
GILVHGGVVDKHATSYAFHGLTPGYLYNLTVMTEAAGLQNYRWKLVRTAPMEVSNLKVTN
DGSLTSLKVKWQRPPGNVDSYNITLSHKGTIKESRVLAPWITETHFKELVPGRLYQVTVS
CVSGELSAQKMAVGRTFPDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVL
LNIAVGKEETQYVMNDTGFVPGRQYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHAN
ETSLSIMWQAPVAEWEKYIISLADRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSIS
GDLKNSSSVKGRTVPAQVTDLHVANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNE
SISSEISRYSFHSLKSGSLYSVVVTTVSGGISSRQVVVEGRTAFKITVPSSVSGVTVKNS
GRNDYLSVSWLLAPGDVDNHEVTLSHDGKVVQSLVIAKSVRECSFSSLTPGRLYTVTITT
RSGKYENHSFSQERTVPDKVQGVSVSNSARSDYLRVSWVHATGDFDHYEVTIKNKNNFIQ
TKSIPKSENECVFAQLVPGRLYSVTVTTKSGQYEASEQGNGRTIPEPVKDLTLRNRSTED
LHVTWSGANGDVDQYEIQLLFNDMKVFPPFHLVNTATEYRFTSLTPGRQYKILVLTISGD
VQQSAFIEGFTVPSAVKNIHISPNGATDSLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTI
PKHVFEHTFHRLEAGEQYQIMIASVSGSLKNQINVVGRTVPASVQGVIADNAYSSHSLTV
SWQKAAGVAERYDILLLTENGILLRNTSEPATTKQHKFEDLTPGKKYKIQILTVSGGLFS
KEAQTEGRTVPAAVTDLRITENSTRHLSFRWTASEGELSWYNIFLYNPDGNLQERAQVDP
QVQSFSFQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPASVSHLRGSNRNTTDSLWFNW
SPASGDFDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYMLWVVTHSGDLSNKVT
AESRTAPSPPSLMSFADIANTSLAITWKGPPDWTDYNDFELQWLPRDALTVFNPYNNRKS
EGRIVYGLRPGRSYQFNVKTVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACS
WIPPDSDFDGYSIECRKMDTQEVEFSRKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTS
EVVEDSTITMIDRPPPPPPHIRVNEKDVLISKSSINFTVNCSWFSDTNGAVKYFTVVVRE
ADGSDELKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMES
LGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPITTESE
PLFGAIEGVSAGLFLIGMLVAVVALLICRQKVSHGRERPSARLSIRRDRPLSVHLNLGQK
GNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYN
NILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQN
VHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICSEEQL
DAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTF
IALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQE
NPLFPIYENVNPEYHRDPVYSRH
Download sequence
Identical sequences ENSGGOP00000006172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]